Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RMD1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RMD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157839
|
Novus Biologicals
NBP157839 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
RMD1 Polyclonal specifically detects RMD1 in Human samples. It is validated for Western Blot.Specifications
| RMD1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q96DB5 | |
| 51115 | |
| Synthetic peptides corresponding to FAM82B(family with sequence similarity 82, member B) The peptide sequence was selected from the N terminal of FAM82B. Peptide sequence MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGT. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CGI-90, family with sequence similarity 82, member B, FLJ20665, hRMD-1, microtubule-associated protein, Protein FAM82B, regulator of microtubule dynamics 1, regulator of microtubule dynamics protein 1, RMD1, RMD-1 | |
| FAM82B | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title