Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNase L Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179944

 View more versions of this product

Catalog No. NBP179944

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

RNase L Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

RNase L
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
RNASEL
Synthetic peptide directed towards the C terminal of human RNASEL. Peptide sequence MKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGA.
84 kDa
100ul
Chromatin Research, Cytokine Research, DNA replication Transcription Translation and Splicing, Immunology, Innate Immunity, Prostate Cancer, Protein Kinase
Primary
6041
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Western Blot
Western Blot 1:1000
NP_066956
2-5A-dependent ribonuclease, 2-5A-dependent RNase, 2'-5'-oligoisoadenylate synthetase-dependent, EC 3.1.26.-, HPC1, interferon-induced 2-5A-dependent RNase, MGC104972, MGC133329, PRCA1, prostate cancer 1, Ribonuclease 4, Ribonuclease L, ribonuclease L (2'-5'-oligoisoadenylate synthetase-dependent), RNase L, RNS4DKFZp781D08126
Rabbit
IgG
Protein A purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Bovine: 78%.
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit