Learn More
Abnova™ RNASE1 Recombinant Protein
Human RNASE1 full-length ORF recombinant protein with GST-tag at N-terminal
Supplier: Abnova™ H00006035P0125
Description
This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified.
- Theoretical MW (kDa): 42.90
- Preparation Method: In vitro wheat germ expression system
- Purification:Glutathione Sepharose 4 fast flow
- Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
Antibody Production, ELISA, Protein Array, Western Blot | |
42.9 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
25μg | |
-80°C | |
Recombinant |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
Human RNASE1 Full-length ORF Recombinant Protein with GST-tag at N-terminal | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE stained with Coomassie Blue | |
Wheat Germ (in vitro) | |
Human | |
Solution |
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.