Abnova™ RNASE1 Recombinant Protein

Human RNASE1 full-length ORF recombinant protein with GST-tag at N-terminal

Supplier:  Abnova™ H00006035P0125

Catalog No. 89-010-537

Description

This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified.

• Theoretical MW (kDa): 42.90
• Preparation Method: In vitro wheat germ expression system
• Purification:Glutathione Sepharose 4 fast flow
• Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Sequence: MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST

Best when used within three months from the date of receipt.

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Molecular Weight (g/mol): 42.9
• pH Range: 8
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quantity: 25μg
• Storage Requirements: -80°C
• Recombinant: Recombinant

• Formulation: 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
• Name: Human RNASE1 Full-length ORF Recombinant Protein with GST-tag at N-terminal
• Preparation Method: In vitro wheat germ expression system
• Quality Control Testing: 12.5% SDS-PAGE stained with Coomassie Blue
• Source: Wheat Germ (in vitro)
• Cross Reactivity: Human
• Form: Solution