RNASE11 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157953

Catalog No. NBP157953

Description

RNASE11 Polyclonal specifically detects RNASE11 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RNASE11
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TAA1
• Gene Symbols: RNASE11
• Immunogen: Synthetic peptides corresponding to RNASE11(ribonuclease, RNase A family, 11 (non-active)) The peptide sequence was selected from the middle region of RNASE11. Peptide sequence GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Guinea pig: 83%.
• Target Species: Human, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C14orf6, chromosome 14 open reading frame 6, EC 3.1.27.-, probable ribonuclease 11, ribonuclease 11, ribonuclease, RNase A family, 11 (non-active), RNase 11
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 122651
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.