Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNASE11 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RNASE11 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157953
|
Novus Biologicals
NBP157953 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
RNASE11 Polyclonal specifically detects RNASE11 in Human samples. It is validated for Western Blot.Specifications
| RNASE11 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C14orf6, chromosome 14 open reading frame 6, EC 3.1.27.-, probable ribonuclease 11, ribonuclease 11, ribonuclease, RNase A family, 11 (non-active), RNase 11 | |
| RNASE11 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8TAA1 | |
| 122651 | |
| Synthetic peptides corresponding to RNASE11(ribonuclease, RNase A family, 11 (non-active)) The peptide sequence was selected from the middle region of RNASE11. Peptide sequence GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title