RNASE9 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155370

Catalog No. NBP155370

Description

RNASE9 Polyclonal specifically detects RNASE9 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RNASE9
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P60153
• Gene Symbols: RNASE9
• Immunogen: Synthetic peptides corresponding to RNASE9(ribonuclease, RNase A family, 9 (non-active)) The peptide sequence was selected from the N terminal of RNASE9. Peptide sequence PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNH.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 390443
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: h461, HEL128, ribonuclear enzyme, ribonuclease 9, ribonuclease, RNase A family, 9 (non-active), ribonuclease-like protein 9
• Host Species: Rabbit
• Molecular Weight of Antigen: 24 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Porcine: 86%.
• Target Species: Human, Porcine
• Isotype: IgG