Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF113A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18031820UL
Description
RNF113A Polyclonal specifically detects RNF113A in Human samples. It is validated for Western Blot.Specifications
RNF113A | |
Polyclonal | |
Western Blot 1:1000 | |
NP_008909 | |
RNF113A | |
Synthetic peptide directed towards the middle region of human RNF113A. Peptide sequence LQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPD. | |
20 μL | |
Zinc Finger | |
7737 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
ring finger protein 113A, RNF113Cwc24, Zinc finger protein 183, zinc finger protein 183 (RING finger, C3HC4 type), ZNF183 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction