Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF113A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen RNF113A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP18031820
View Documents
Novus Biologicals
NBP18031820UL
20 μL
Each for $152.22
Add to cart
 
NBP180318
View Documents
Novus Biologicals
NBP180318
100 μL
Each for $436.00
Add to cart
 
Description

Description

RNF113A Polyclonal specifically detects RNF113A in Human samples. It is validated for Western Blot.
Specifications

Specifications

RNF113A
Polyclonal
Rabbit
Zinc Finger
ring finger protein 113A, RNF113Cwc24, Zinc finger protein 183, zinc finger protein 183 (RING finger, C3HC4 type), ZNF183
RNF113A
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
NP_008909
7737
Synthetic peptide directed towards the middle region of human RNF113A. Peptide sequence LQHFRTTPRCYVCDQQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPD.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit