Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF113B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310345100UL
Description
RNF113B Polyclonal specifically detects RNF113B in Human samples. It is validated for Western Blot.Specifications
RNF113B | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
bA10G5.1, MGC26599, ring finger protein 113B, Zinc finger protein 183-like 1RNF161ZNF183L1 | |
The immunogen is a synthetic peptide directed towards the middle region of human RNF113B (NP_849192). Peptide sequence HDHIYRGIHSYLRYLKPKDTSMGNSSSGMARKGPIRAPGHLRATVRWDYQ | |
100 μg | |
Zinc Finger | |
140432 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction