Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF133 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RNF133 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RNF133 Polyclonal specifically detects RNF133 in Human samples. It is validated for Western Blot.Specifications
RNF133 | |
Polyclonal | |
Rabbit | |
Zinc Finger | |
E3 ubiquitin-protein ligase RNF133, EC 6.3.2.-, ring finger protein 133MGC27072 | |
RNF133 | |
IgG | |
42 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q8WVZ7 | |
168433 | |
Synthetic peptides corresponding to RNF133(ring finger protein 133) The peptide sequence was selected from the N terminal of RNF133. Peptide sequence VVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVIVPPEGKIQNA. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title