Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF133 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP162487
Description
RNF133 Polyclonal specifically detects RNF133 in Human samples. It is validated for Western Blot.Specifications
| RNF133 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| Q8WVZ7 | |
| RNF133 | |
| Synthetic peptides corresponding to RNF133(ring finger protein 133) The peptide sequence was selected from the N terminal of RNF133. Peptide sequence VVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVIVPPEGKIQNA. | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS & 2% Sucrose. with 0.09% Sodium Azide | |
| E3 ubiquitin-protein ligase RNF133, EC 6.3.2.-, ring finger protein 133MGC27072 | |
| Rabbit | |
| 42 kDa | |
| 100 μL | |
| Zinc Finger | |
| 168433 | |
| Human, Mouse, Rat, Equine, Rabbit | |
| IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title