Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF133 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RNF133 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP162487
|
Novus Biologicals
NBP162487 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
RNF133 Polyclonal specifically detects RNF133 in Human samples. It is validated for Western Blot.Specifications
| RNF133 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| E3 ubiquitin-protein ligase RNF133, EC 6.3.2.-, ring finger protein 133MGC27072 | |
| RNF133 | |
| IgG | |
| Affinity Purified | |
| 42 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8WVZ7 | |
| 168433 | |
| Synthetic peptides corresponding to RNF133(ring finger protein 133) The peptide sequence was selected from the N terminal of RNF133. Peptide sequence VVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVIVPPEGKIQNA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title