Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF139 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15975620UL
Description
RNF139 Polyclonal specifically detects RNF139 in Human samples. It is validated for Western Blot.Specifications
RNF139 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8WU17 | |
RNF139 | |
Synthetic peptides corresponding to RNF139(ring finger protein 139) The peptide sequence was selected from the N terminal of RNF139. Peptide sequence SQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPR. | |
20 μL | |
Zinc Finger | |
11236 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
EC 6.3.2.-, HRCA1, patched related protein translocated in renal cancer, RCA1multiple membrane spanning receptor TRC8, ring finger protein 139MGC31961, Translocation in renal carcinoma on chromosome 8 protein, TRC8E3 ubiquitin-protein ligase RNF139 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title