Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF139 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen RNF139
Immunogen Synthetic peptides corresponding to RNF139(ring finger protein 139) The peptide sequence was selected from the N terminal of RNF139. Peptide sequence SQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPR.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15975620 View Documents Novus BiologicalsSupplier Diversity Partner
NBP15975620UL
20ul Each for $149.00
Add to cart
 
NBP159756 View Documents Novus BiologicalsSupplier Diversity Partner
NBP159756
100 ul Each for $329.00
Add to cart
 
Description

Description

RNF139 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

RNF139
Rabbit
Polyclonal
Unconjugated
11236
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to RNF139(ring finger protein 139) The peptide sequence was selected from the N terminal of RNF139. Peptide sequence SQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPR.
Primary
IgG
EC 6.3.2.-, HRCA1, patched related protein translocated in renal cancer, RCA1multiple membrane spanning receptor TRC8, ring finger protein 139MGC31961, Translocation in renal carcinoma on chromosome 8 protein, TRC8E3 ubiquitin-protein ligase RNF139
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit