Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF141 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen RNF141
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry
Applications Western Blot, Immunohistochemistry
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125564
View Documents
Novus Biologicals
NBP31033125UL
25 μg
Each for $106.19
Add to cart
 
NB125563
View Documents
Novus Biologicals
NBP310331100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

RNF141 Polyclonal antibody specifically detects RNF141 in Human samples. It is validated for Western Blot, Immunohistochemistry
Specifications

Specifications

RNF141
Western Blot, Immunohistochemistry
Purified
RUO
Human
C3HC4-like zinc finger protein, MGC8715, ring finger protein 141, Zinc finger protein 230, ZNF230ZFP26
The immunogen is a synthetic peptide directed towards the middle region of human RNF141 (NP_057506). Peptide sequence RIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQASLWMGR
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Immunohistochemistry
Unconjugated
Rabbit
Zinc Finger
PBS buffer, 2% sucrose
50862
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit