Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF175 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15507920UL

 View more versions of this product

Catalog No. NBP15507920


Add to cart

Description

Description

RNF175 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

RNF175
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
RNF175
Synthetic peptides corresponding to RNF175(ring finger protein 175) The peptide sequence was selected from the middle region of RNF175. Peptide sequence YGLYYGVMGRDFAEICSDYMASTIGFYSVSRLPTRSLSDNICAVCGQKII.
19 kDa
20ul
Zinc Finger
Primary
285533
Western Blot
Western Blot 1:100-1:2000
Q8NB61
FLJ34190, ring finger protein 175
Rabbit
IgG
Protein A purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit