Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF182 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15976320UL
Description
RNF182 Polyclonal specifically detects RNF182 in Human samples. It is validated for Western Blot.Specifications
RNF182 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8N6D2 | |
RNF182 | |
Synthetic peptides corresponding to RNF182(ring finger protein 182) The peptide sequence was selected from the middle region of RNF182. Peptide sequence LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY. | |
20 μL | |
Zinc Finger | |
221687 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
E3 ubiquitin-protein ligase RNF182, EC 6.3.2.-, FLJ40772, ring finger protein 182MGC33993 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction