Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF185 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | RNF185 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1597620
|
Novus Biologicals
NBP15976120UL |
20 μL |
Each for $204.00
|
|
|||||
NBP159761
|
Novus Biologicals
NBP159761 |
100 μL |
Each for $482.50
|
|
|||||
Description
RNF185 Polyclonal specifically detects RNF185 in Human samples. It is validated for Western Blot.Specifications
RNF185 | |
Polyclonal | |
Rabbit | |
Zinc Finger | |
BSK65-MONO1, BSK65-MONO2, BSK65-PANC1, BSK65-PANC2, BSK65-TEST1, BSK65-TEST2, BSK65-TEST3, FLJ38628, ring finger protein 185 | |
RNF185 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q96GF1 | |
91445 | |
Synthetic peptides corresponding to RNF185(ring finger protein 185) The peptide sequence was selected from the middle region of RNF185. Peptide sequence QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title