RNF186 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159773

Catalog No. NBP159773

Description

RNF186 Polyclonal specifically detects RNF186 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RNF186
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NXI6
• Gene Symbols: RNF186
• Immunogen: Synthetic peptides corresponding to RNF186(ring finger protein 186) The peptide sequence was selected from the N terminal of RNF186. Peptide sequence MACTKTLQQSQPISAGATTTTTAVAPAGGHSGSTECDLECLVCREPYSCP.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%;.
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: FLJ20225, ring finger protein 186, RP11-91K11.1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54546
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.