Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF207 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
Antigen | RNF207 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15479420
|
Novus Biologicals
NBP15479420UL |
20 μL |
Each for $204.00
|
|
|||||
NBP154794
|
Novus Biologicals
NBP154794 |
100 μL |
Each for $482.50
|
|
|||||
Description
RNF207 Polyclonal specifically detects RNF207 in Human samples. It is validated for Western Blot.Specifications
RNF207 | |
Polyclonal | |
Rabbit | |
Zinc Finger | |
C1orf188, chromosome 1 open reading frame 188, FLJ32096, FLJ46380, FLJ46593, ring finger protein 207 | |
RNF207 | |
IgG | |
71 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q6ZRF8 | |
388591 | |
Synthetic peptides corresponding to RNF207(ring finger protein 207) The peptide sequence was selected from the N terminal of RNF207 (NP_997279). Peptide sequence CLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFL. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title