Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF207 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen RNF207
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15479420
View Documents
Novus Biologicals
NBP15479420UL
20 μL
Each for $152.22
N/A
NBP154794
View Documents
Novus Biologicals
NBP154794
100 μL
Each for $436.00
N/A
Description

Description

RNF207 Polyclonal specifically detects RNF207 in Human samples. It is validated for Western Blot.
Specifications

Specifications

RNF207
Polyclonal
Rabbit
Zinc Finger
C1orf188, chromosome 1 open reading frame 188, FLJ32096, FLJ46380, FLJ46593, ring finger protein 207
RNF207
IgG
Affinity Purified
71 kDa
Western Blot
Unconjugated
RUO
Q6ZRF8
388591
Synthetic peptides corresponding to RNF207(ring finger protein 207) The peptide sequence was selected from the N terminal of RNF207 (NP_997279). Peptide sequence CLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFL.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit