Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF212 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15508320UL

 View more versions of this product

Catalog No. NBP15508320


Add to cart

Description

Description

RNF212 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

RNF212
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
RNF212
Synthetic peptides corresponding to RNF212(ring finger protein 212) The peptide sequence was selected from the middle region of RNF212. Peptide sequence LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS.
26 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:100-1:2000
Q495C1-5
FLJ38841, FLJ42587, hypothetical protein LOC285498, MGC120227, MGC120228, ring finger protein 212, ZHP3
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
285498
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit