RNF212 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155083

Catalog No. NBP155083

Description

RNF212 Polyclonal specifically detects RNF212 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RNF212
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q495C1-5
• Gene Symbols: RNF212
• Immunogen: Synthetic peptides corresponding to RNF212(ring finger protein 212) The peptide sequence was selected from the middle region of RNF212. Peptide sequence LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 285498
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with 0.09% Sodium Azide
• Gene Alias: FLJ38841, FLJ42587, hypothetical protein LOC285498, MGC120227, MGC120228, ring finger protein 212, ZHP3
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Canine: 86%.
• Target Species: Human, Mouse, Canine, Rabbit
• Isotype: IgG