Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF212 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen RNF212
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155083
View Documents
Novus Biologicals
NBP155083
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

RNF212 Polyclonal specifically detects RNF212 in Human samples. It is validated for Western Blot.
Specifications

Specifications

RNF212
Polyclonal
Rabbit
Q495C1-5
285498
Synthetic peptides corresponding to RNF212(ring finger protein 212) The peptide sequence was selected from the middle region of RNF212. Peptide sequence LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
FLJ38841, FLJ42587, hypothetical protein LOC285498, MGC120227, MGC120228, ring finger protein 212, ZHP3
RNF212
IgG
Affinity Purified
26 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit