RNF25 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155063

Catalog No. NBP155063

Description

RNF25 Polyclonal specifically detects RNF25 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RNF25
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AO7, EC 6.3.2.-, FLJ13906, ring finger protein 25E3 ubiquitin-protein ligase RNF25, ring finger protein AO7
• Host Species: Rabbit
• Molecular Weight of Antigen: 51 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism, Zinc Finger
• Gene ID (Entrez): 64320
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q96BH1
• Gene Symbols: RNF25
• Immunogen: Synthetic peptides corresponding to RNF25(ring finger protein 25) The peptide sequence was selected from the middle region of RNF25. Peptide sequence CREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.