Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF25 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | RNF25 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155063
|
Novus Biologicals
NBP155063 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
RNF25 Polyclonal specifically detects RNF25 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RNF25 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism, Zinc Finger | |
| AO7, EC 6.3.2.-, FLJ13906, ring finger protein 25E3 ubiquitin-protein ligase RNF25, ring finger protein AO7 | |
| RNF25 | |
| IgG | |
| 51 kDa |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Q96BH1 | |
| 64320 | |
| Synthetic peptides corresponding to RNF25(ring finger protein 25) The peptide sequence was selected from the middle region of RNF25. Peptide sequence CREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGG. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title