Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF25 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen RNF25
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155063
View Documents
Novus Biologicals
NBP155063
100 μL
Each for $436.00
N/A
NBP15506320
View Documents
Novus Biologicals
NBP15506320UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

RNF25 Polyclonal specifically detects RNF25 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

RNF25
Polyclonal
Rabbit
Lipid and Metabolism, Zinc Finger
AO7, EC 6.3.2.-, FLJ13906, ring finger protein 25E3 ubiquitin-protein ligase RNF25, ring finger protein AO7
RNF25
IgG
Affinity Purified
51 kDa
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
RUO
Q96BH1
64320
Synthetic peptides corresponding to RNF25(ring finger protein 25) The peptide sequence was selected from the middle region of RNF25. Peptide sequence CREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGG.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit