Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF32 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RNF32 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155067
|
Novus Biologicals
NBP155067 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
RNF32 Polyclonal specifically detects RNF32 in Human samples. It is validated for Western Blot.Specifications
| RNF32 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FKSG33, HSD15, ring finger protein 32 | |
| RNF32 | |
| IgG | |
| Protein A purified | |
| 40 kDa |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Zinc Finger | |
| Q9H0A6 | |
| 140545 | |
| Synthetic peptides corresponding to RNF32(ring finger protein 32) The peptide sequence was selected from the middle region of RNF32. Peptide sequence ACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGC. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title