Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF38 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15310820UL

 View more versions of this product

Catalog No. NBP15310820

Add to cart



RNF38 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.


PBS and 2% Sucrose with 0.09% Sodium Azide
FLJ21343, ring finger protein 38
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Western Blot 1:100-1:2000
Synthetic peptides corresponding to RNF38(ring finger protein 38) The peptide sequence was selected from the N terminal of RNF38. Peptide sequence FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP.
Protein A purified
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit