Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF38 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15310820UL
Description
RNF38 Polyclonal specifically detects RNF38 in Human samples. It is validated for Western Blot.Specifications
RNF38 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
FLJ21343, ring finger protein 38 | |
Rabbit | |
Protein A purified | |
RUO | |
152006 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
RNF38 | |
Synthetic peptides corresponding to RNF38(ring finger protein 38) The peptide sequence was selected from the N terminal of RNF38. Peptide sequence FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP. | |
20 μL | |
Primary | |
Human | |
Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction