Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF38 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | RNF38 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15310820
|
Novus Biologicals
NBP15310820UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP153108
|
Novus Biologicals
NBP153108 |
100 μL |
Each for $482.50
|
|
|||||
Description
RNF38 Polyclonal specifically detects RNF38 in Human samples. It is validated for Western Blot.Specifications
| RNF38 | |
| Polyclonal | |
| Purified | |
| RUO | |
| 152006 | |
| Synthetic peptides corresponding to RNF38(ring finger protein 38) The peptide sequence was selected from the N terminal of RNF38. Peptide sequence FDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| FLJ21343, ring finger protein 38 | |
| RNF38 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title