Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNPEPL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RNPEPL1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156882
|
Novus Biologicals
NBP156882 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
RNPEPL1 Polyclonal specifically detects RNPEPL1 in Human samples. It is validated for Western Blot.Specifications
| RNPEPL1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| argininyl aminopeptidase-like 1, arginyl aminopeptidase (aminopeptidase B)-like 1, arginyl aminopeptidase-like 1, EC 3.4.11.-, FLJ10806, FLJ26675, MGC99544, RNPEP-like 1 | |
| RNPEPL1 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9HAU8 | |
| 57140 | |
| Synthetic peptides corresponding to RNPEPL1(arginyl aminopeptidase (aminopeptidase B)-like 1) The peptide sequence was selected from the N terminal of RNPEPL1. Peptide sequence LKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title