ROR1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198395

Catalog No. NBP198395

Description

ROR1 Polyclonal specifically detects ROR1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ROR1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_005003
• Gene Symbols: ROR1
• Immunogen: The immunogen for this antibody is ROR1 - N-terminal region. Peptide sequence TASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITA.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.7.10.1, MGC99659, neurotrophic tyrosine kinase receptor-related 1, Neurotrophic tyrosine kinase, receptor-related 1, NTRKR1dJ537F10.1, receptor tyrosine kinase-like orphan receptor 1, tyrosine-protein kinase transmembrane receptor ROR1
• Host Species: Rabbit
• Molecular Weight of Antigen: 104 kDa
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 4919
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG