Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ROR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$157.00 - $482.50
Specifications
Antigen | ROR1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP19839520
|
Novus Biologicals
NBP19839520UL |
20 μL |
Each for $157.00
|
|
|||||
NBP198395
|
Novus Biologicals
NBP198395 |
100 μL |
Each for $482.50
|
|
|||||
Description
ROR1 Polyclonal specifically detects ROR1 in Human samples. It is validated for Western Blot.Specifications
ROR1 | |
Polyclonal | |
Rabbit | |
Protein Kinase | |
EC 2.7.10.1, MGC99659, neurotrophic tyrosine kinase receptor-related 1, Neurotrophic tyrosine kinase, receptor-related 1, NTRKR1dJ537F10.1, receptor tyrosine kinase-like orphan receptor 1, tyrosine-protein kinase transmembrane receptor ROR1 | |
ROR1 | |
IgG | |
104 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_005003 | |
4919 | |
The immunogen for this antibody is ROR1 - N-terminal region. Peptide sequence TASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITA. | |
Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title