Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | RP2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15685220
|
Novus Biologicals
NBP15685220UL |
20 μL |
Each for $152.22
|
|
NBP156852
|
Novus Biologicals
NBP156852 |
100 μL |
Each for $436.00
|
|
Description
RP2 Polyclonal specifically detects RP2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RP2 | |
| Polyclonal | |
| Rabbit | |
| Vision | |
| O75695 | |
| 6102 | |
| Synthetic peptides corresponding to RP2(retinitis pigmentosa 2 (X-linked recessive)) The peptide sequence was selected from the middle region of RP2. Peptide sequence LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DELXp11.3, KIAA0215, NME10, protein XRP2, retinitis pigmentosa 2 (X-linked recessive), TBCCD2, XRP2 | |
| RP2 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title