Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RPB8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP153016

 View more versions of this product

Catalog No. NBP153016


Add to cart

Description

Description

RPB8 Polyclonal antibody specifically detects RPB8 in Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

RPB8
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Purified
POLR2H
Synthetic peptides corresponding to POLR2H(polymerase (RNA) II (DNA directed) polypeptide H) The peptide sequence was selected from the N terminal of human POLR2H. Peptide sequence DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE.
17 kDa
100ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
This product is specific to Subunit or Isoform: RPABC3.
Bovine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Western Blot
Western Blot 5 ug/ml
P52434
DNA-directed RNA polymerases I, II, and III subunit RPABC3, hsRPB8, II, and III 17.1 kDa polypeptide, II, and III subunit ABC3, polymerase (RNA) II (DNA directed) polypeptide H, RPB8 homolog
Rabbit
IgG
Protein A purified
RUO
Primary
5437
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit