Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RPE65 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen RPE65
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125485
View Documents
Novus Biologicals
NBP310292100UL
100 μg
Each for $352.89
Add to cart
 
NB125486
View Documents
Novus Biologicals
NBP31029225UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

RPE65 Polyclonal antibody specifically detects RPE65 in Human samples. It is validated for Western Blot
Specifications

Specifications

RPE65
Western Blot
Purified
RUO
Human
All-trans-retinyl-palmitate hydrolase, BCO family, member 3, BCO3, EC 3.1.1.64, EC:3.1.1.64, EC:5.3.3.22, LCA2, lutein isomerase, meso-zeaxanthin isomerase, mRPE65, p63, RBP-binding membrane protein, rd12, retinal pigment epithelium specific protein 65, Retinal pigment epithelium-specific 65 kDa protein, retinal pigment epithelium-specific protein 65kDa, retinitis pigmentosa 20 (autosomal recessive), retinoid isomerohydrolase, Retinol isomerase, RP20, RPE65, RPE65, retinoid isomerohydrolase, sRPE65
The immunogen is a synthetic peptide directed towards the middle region of Human RPE65. Peptide sequence LFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYLNNKYRTSPFN
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Cellular Markers, Lipid and Metabolism, Neuronal Cell Markers, Neuroscience, Sensory Systems, Signal Transduction, Vision
PBS buffer, 2% sucrose
6121
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit