Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RPL37A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP155204

 View more versions of this product

Catalog No. NBP155204


Add to cart

Description

Description

RPL37A Polyclonal antibody specifically detects RPL37A in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

RPL37A
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
RPL37A
Synthetic peptides corresponding to RPL37A(ribosomal protein L37a) The peptide sequence was selected from the middle region of RPL37A. Peptide sequence CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD.
101 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Goat: 79%.
Bovine, Canine, Equine, Goat, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Western Blot
Western Blot 1:100-1:2000
P61513
60S ribosomal protein L37a, MGC74786, ribosomal protein L37a
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
6168
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit