RPL37A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155204

Catalog No. NBP155204

Description

RPL37A Polyclonal specifically detects RPL37A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RPL37A
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P61513
• Gene Symbols: RPL37A
• Immunogen: Synthetic peptides corresponding to RPL37A(ribosomal protein L37a) The peptide sequence was selected from the middle region of RPL37A. Peptide sequence CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6168
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 60S ribosomal protein L37a, MGC74786, ribosomal protein L37a
• Host Species: Rabbit
• Molecular Weight of Antigen: 101 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Goat: 79%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG