Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RPL37A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP155204
Description
RPL37A Polyclonal specifically detects RPL37A in Human samples. It is validated for Western Blot.Specifications
RPL37A | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
60S ribosomal protein L37a, MGC74786, ribosomal protein L37a | |
Rabbit | |
101 kDa | |
100 μL | |
Primary | |
Goat: 79%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P61513 | |
RPL37A | |
Synthetic peptides corresponding to RPL37A(ribosomal protein L37a) The peptide sequence was selected from the middle region of RPL37A. Peptide sequence CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD. | |
Affinity purified | |
RUO | |
6168 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction