Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RPL37A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | RPL37A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15520420
|
Novus Biologicals
NBP15520420UL |
20 μL |
Each for $152.22
|
|
NBP155204
|
Novus Biologicals
NBP155204 |
100 μL |
Each for $436.00
|
|
Description
RPL37A Polyclonal specifically detects RPL37A in Human samples. It is validated for Western Blot.Specifications
| RPL37A | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 60S ribosomal protein L37a, MGC74786, ribosomal protein L37a | |
| RPL37A | |
| IgG | |
| Affinity Purified | |
| 101 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P61513 | |
| 6168 | |
| Synthetic peptides corresponding to RPL37A(ribosomal protein L37a) The peptide sequence was selected from the middle region of RPL37A. Peptide sequence CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title