Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RPL37A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen RPL37A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15520420
View Documents
Novus Biologicals
NBP15520420UL
20 μL
Each for $152.22
Add to cart
 
NBP155204
View Documents
Novus Biologicals
NBP155204
100 μL
Each for $436.00
Add to cart
 
Description

Description

RPL37A Polyclonal specifically detects RPL37A in Human samples. It is validated for Western Blot.
Specifications

Specifications

RPL37A
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
60S ribosomal protein L37a, MGC74786, ribosomal protein L37a
RPL37A
IgG
Affinity Purified
101 kDa
Western Blot
Unconjugated
RUO
P61513
6168
Synthetic peptides corresponding to RPL37A(ribosomal protein L37a) The peptide sequence was selected from the middle region of RPL37A. Peptide sequence CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit