Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RPL9 Rabbit anti-Human, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against recombinant human RPL9.

Manufacturer:  Abnova Corporation PAB29404

Catalog No. 89-934-870


Add to cart

Description

Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L6P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Sequence: SVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRPGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE
Specifications

Specifications

RPL9
Unconjugated
Immunohistochemistry Immunofluorescence (1-4 ug/mL) Western Blot The optimal working dilution should be determined by the end user.
Liquid
RPL9
Recombinant protein corresponding to human RPL9.
Antigen affinity purification
RUO
Primary
6133
Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Rabbit polyclonal antibody raised against recombinant human RPL9.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
DKFZp313J1510/FLJ27456/MGC15545/NPC-A-16
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit