Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RPS15A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RPS15A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155208
|
Novus Biologicals
NBP155208 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
RPS15A Polyclonal specifically detects RPS15A in Human samples. It is validated for Western Blot.Specifications
| RPS15A | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 40S ribosomal protein S15a, FLJ27457, MGC111208, ribosomal protein S15a, S15a, up-regulated by HBV X protein | |
| RPS15A | |
| IgG | |
| Affinity Purified | |
| 15 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| P62244 | |
| 6210 | |
| Synthetic peptides corresponding to RPS15A(ribosomal protein S15a) The peptide sequence was selected from the middle region of RPS15A. Peptide sequence KCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title