Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RPS7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15739420UL
Description
RPS7 Polyclonal specifically detects RPS7 in Human samples. It is validated for Western Blot.Specifications
RPS7 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P62081 | |
RPS7 | |
Synthetic peptides corresponding to RPS7(ribosomal protein S7) The peptide sequence was selected from the N terminal of RPS7. Peptide sequence MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DBA8,40S ribosomal protein S7, ribosomal protein S7 | |
Rabbit | |
Affinity Purified | |
RUO | |
6201 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction