RPS7 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157394

Catalog No. NBP157394

Description

RPS7 Polyclonal specifically detects RPS7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RPS7
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P62081
• Gene Symbols: RPS7
• Immunogen: Synthetic peptides corresponding to RPS7(ribosomal protein S7) The peptide sequence was selected from the N terminal of RPS7. Peptide sequence MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 6201
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DBA8,40S ribosomal protein S7, ribosomal protein S7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Porcine, Canine, Rabbit
• Isotype: IgG