RPUSD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180476

Catalog No. NBP180476

Description

RPUSD2 Polyclonal specifically detects RPUSD2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RPUSD2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C15orf19, C18B11, C18B11 homolog (44.9kD), chromosome 15 open reading frame 19, FLJ31409, RNA pseudouridylate synthase domain containing 2, RNA pseudouridylate synthase domain-containing protein 2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27079
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_689473
• Gene Symbols: RPUSD2
• Immunogen: Synthetic peptide directed towards the C terminal of human RPUSD2. Peptide sequence AEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Equine: 92%; Rat: 92%; Bovine: 85%; Canine: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine
• Isotype: IgG