Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RRAGA Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | RRAGA |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB124803
|
Novus Biologicals
NBP309951100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
RRAGA Polyclonal specifically detects RRAGA in Human samples. It is validated for Western Blot.Specifications
RRAGA | |
Western Blot | |
Unconjugated | |
Rabbit | |
Cancer, mTOR Pathway | |
PBS buffer, 2% sucrose | |
10670 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
Adenovirus E3 14.7 kDa-interacting protein 1, FIP1, FIP-1adenovirus E3-14.7K interacting protein 1, Rag A, RagA, RAGAras-related GTP-binding protein A, Ras-related GTP binding A | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RRAGA. Peptide sequence CKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTS | |
Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title