Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RRAGC Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RRAGC |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156670
|
Novus Biologicals
NBP156670 |
100 μL |
Each for $436.00
|
|
NBP15667020
|
Novus Biologicals
NBP15667020UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
RRAGC Polyclonal specifically detects RRAGC in Human samples. It is validated for Western Blot.Specifications
| RRAGC | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, mTOR Pathway | |
| Q9HB90 | |
| 64121 | |
| Synthetic peptides corresponding to RRAGC (Ras-related GTP binding C) The peptide sequence was selected from the N terminal of RRAGC)(50ug). Peptide sequence RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ13311, GTPase-interacting protein 2, GTR2, Rag C, Rag C protein, RAGC, Ras-related GTP binding C, ras-related GTP-binding protein C, TIB929 | |
| RRAGC | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title