Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RRM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | RRM1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP158187
|
Novus Biologicals
NBP158187 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
RRM1 Polyclonal specifically detects RRM1 in Human samples. It is validated for Western Blot.Specifications
| RRM1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| P23921 | |
| 6240 | |
| Synthetic peptides corresponding to RRM1(ribonucleotide reductase M1 polypeptide) The peptide sequence was selected from the N terminal of RRM1. Peptide sequence ATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| EC 1.17.4.1, R1, ribonucleoside-diphosphate reductase large subunit, Ribonucleoside-diphosphate reductase subunit M1, Ribonucleotide reductase large subunit, ribonucleotide reductase M1, ribonucleotide reductase M1 polypeptide, ribonucleotide reductase, large subunit, ribonucleotide reductase, R1 subunit, RIR1, RR1 | |
| RRM1 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title