Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RSPRY1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15507020UL

 View more versions of this product

Catalog No. NBP15507020


Add to cart

Description

Description

RSPRY1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

RSPRY1
Unconjugated
PBS & 2% Sucrose. with No Preservative
Affinity Purified
RSPRY1
Synthetic peptides corresponding to RSPRY1(ring finger and SPRY domain containing 1) The peptide sequence was selected from the N terminal of RSPRY1. Peptide sequence RSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPY.
64 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:100-1:2000
Q96DX4
KIAA1972RING finger and SPRY domain-containing protein 1, ring finger and SPRY domain containing 1
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
89970
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit