Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RSRC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen RSRC2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15433220
View Documents
Novus Biologicals
NBP15433220UL
20 μL
Each for $152.22
Add to cart
 
NBP154332
View Documents
Novus Biologicals
NBP154332
100 μL
Each for $436.00
Add to cart
 
Description

Description

RSRC2 Polyclonal specifically detects RSRC2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

RSRC2
Polyclonal
Purified
RUO
Q7L4I2
65117
Synthetic peptides corresponding to RSRC2(arginine/serine-rich coiled-coil 2) The peptide sequence was selected from the C terminal of RSRC2. Peptide sequence DQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
arginine/serine-rich coiled-coil 2, arginine/serine-rich coiled-coil protein 2, FLJ11021
RSRC2
IgG
Protein A purified
50 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit