Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RSRC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | RSRC2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15433220
|
Novus Biologicals
NBP15433220UL |
20 μL |
Each for $152.22
|
|
NBP154332
|
Novus Biologicals
NBP154332 |
100 μL |
Each for $436.00
|
|
Description
RSRC2 Polyclonal specifically detects RSRC2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RSRC2 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q7L4I2 | |
| 65117 | |
| Synthetic peptides corresponding to RSRC2(arginine/serine-rich coiled-coil 2) The peptide sequence was selected from the C terminal of RSRC2. Peptide sequence DQNVKFRKLMGIKSEDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| arginine/serine-rich coiled-coil 2, arginine/serine-rich coiled-coil protein 2, FLJ11021 | |
| RSRC2 | |
| IgG | |
| Protein A purified | |
| 50 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title