Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RTDR1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | RTDR1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156493
|
Novus Biologicals
NBP156493 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
RTDR1 Polyclonal specifically detects RTDR1 in Human samples. It is validated for Western Blot.Specifications
| RTDR1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MGC16968, rhabdoid tumor deletion region gene 1, rhabdoid tumor deletion region protein 1 | |
| Synthetic peptides corresponding to RTDR1(rhabdoid tumor deletion region gene 1) The peptide sequence was selected from the N terminal of RTDR1. Peptide sequence MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMAL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9UHP6 | |
| 27156 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title