Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RTKN Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

$436.00

Specifications

Antigen RTKN
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP154973
View Documents
Novus Biologicals
NBP154973
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

RTKN Polyclonal specifically detects RTKN in Human samples. It is validated for Western Blot.
Specifications

Specifications

RTKN
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
B5, rhotekin, RTKN1
RTKN
IgG
Affinity Purified
63 kDa
Western Blot
Unconjugated
RUO
Q9BST9
6242
Synthetic peptides corresponding to RTKN(rhotekin) The peptide sequence was selected from the N terminal of RTKN (NP_001015055). Peptide sequence DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit