Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RTKN Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$482.50
Specifications
| Antigen | RTKN |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154973
|
Novus Biologicals
NBP154973 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
RTKN Polyclonal specifically detects RTKN in Human samples. It is validated for Western Blot.Specifications
| RTKN | |
| Polyclonal | |
| Rabbit | |
| Q9BST9 | |
| 6242 | |
| Synthetic peptides corresponding to RTKN(rhotekin) The peptide sequence was selected from the N terminal of RTKN (NP_001015055). Peptide sequence DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| B5, rhotekin, RTKN1 | |
| RTKN | |
| IgG | |
| 63 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title