Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RTP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen RTP1
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123828
View Documents
Novus Biologicals
NBP30946325UL
25 μg
Each for $106.19
Add to cart
 
NB123827
View Documents
Novus Biologicals
NBP309463100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

RTP1 Polyclonal antibody specifically detects RTP1 in Human samples. It is validated for Western Blot
Specifications

Specifications

RTP1
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
132112
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Human
MGC35450, receptor (chemosensory) transporter protein 1, receptor transporter protein 1, receptor transporting protein 1, receptor-transporting protein 1
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RTP1 (NP_714919). Peptide sequence RWKLPSLTTDETMCKSVTTDEWKKVFYEKMEEAKPADSWDLIIDPNLKHN
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit