Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RUSC1 antisense RNA 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen RUSC1 antisense RNA 1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15772920
View Documents
Novus Biologicals
NBP15772920UL
20 μL
Each for $152.22
Add to cart
 
NBP157729
View Documents
Novus Biologicals
NBP157729
100 μL
Each for $436.00
Add to cart
 
Description

Description

RUSC1 antisense RNA 1 Polyclonal specifically detects RUSC1 antisense RNA 1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

RUSC1 antisense RNA 1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
chromosome 1 open reading frame 104, FLJ35976, hypothetical protein LOC284618, RP11-21N7.3
RUSC1-AS1
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q66K80
284618
Synthetic peptides corresponding to RUSC1 antisense RNA 1 The peptide sequence was selected from the middle region of RUSC1 antisense RNA 1 (50ug). Peptide sequence APLSCPAPRAQVHRSTPMGRALLTRVLLEPLRPWACPRLPRSPPGGAQSG.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit