Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RUSC1 antisense RNA 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | RUSC1 antisense RNA 1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15772920
|
Novus Biologicals
NBP15772920UL |
20 μL |
Each for $152.22
|
|
NBP157729
|
Novus Biologicals
NBP157729 |
100 μL |
Each for $436.00
|
|
Description
RUSC1 antisense RNA 1 Polyclonal specifically detects RUSC1 antisense RNA 1 in Human samples. It is validated for Western Blot.Specifications
RUSC1 antisense RNA 1 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
chromosome 1 open reading frame 104, FLJ35976, hypothetical protein LOC284618, RP11-21N7.3 | |
RUSC1-AS1 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q66K80 | |
284618 | |
Synthetic peptides corresponding to RUSC1 antisense RNA 1 The peptide sequence was selected from the middle region of RUSC1 antisense RNA 1 (50ug). Peptide sequence APLSCPAPRAQVHRSTPMGRALLTRVLLEPLRPWACPRLPRSPPGGAQSG. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title